Scaffold Ga0208347_100068

Overview

Basic Information

• Taxon OID: 3300026667
• Scaffold ID: Ga0208347_100068
• Source Dataset Name: Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN613 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 973
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location

• Location Name: Gorham, Kansas, USA
• Coordinates
  • Lat. (^o): 39.05
  • Long. (^o): -99.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045906	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208347_1000682	F045906	AGGAG	MNETVKPYRDPIPGRGSIELRRTAAGVYSWVITFWADAIVTDAHLMGMVDSVERVDQELKSRYPESGAKATSE