Scaffold Ga0208282_10239

Overview

Basic Information

• Taxon OID: 3300026560
• Scaffold ID: Ga0208282_10239
• Source Dataset Name: Saline lake microbial communities from Rauer Lake, Antarctica, in enrichment culture - Antartic Rauer Lake 1 Metagenome VIRRA1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5825
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Rauer Lake
• Coordinates
  • Lat. (^o): -68.8136
  • Long. (^o): 77.9341
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102170	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208282_102393	F102170	GGAGG	MSDDDETVIMMTKGRVYHTDETCKRITDRAREWDLDEALNDGRYECGHCQADENLGSKHHGEHLATKLSKADPDEVAPTEFDRERASVSLAWFVAVWLAIMAASTFTGVMLYFAGVLL