NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209690_1200948

Scaffold Ga0209690_1200948


Overview

Basic Information
Taxon OID3300026524 Open in IMG/M
Scaffold IDGa0209690_1200948 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)636
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028506Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0209690_12009481F028506N/AMTAVETEIRQETELVEAWRAEQLEMAGYGAQTAAEIAMRQDIDLHLAIDLLSSGCSAELAAQILL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.