NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257156_1002747

Scaffold Ga0257156_1002747


Overview

Basic Information
Taxon OID3300026498 Open in IMG/M
Scaffold IDGa0257156_1002747 Open in IMG/M
Source Dataset NameSoil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3232
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)44.23Long. (o)-122.22Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036797Metagenome / Metatranscriptome169Y
F045202Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0257156_10027474F045202GAGGMATETADMLIIDRLHELPTFCAFACEDDNPSVVTWIDFWAVEPCGSGEADYLQGQRYADEAIWHVRATGQRVFIECVLVFIAIKLRENDRRAGGLEYGFVDRIARHFPGAIDNVLVRSLRRCSKALN
Ga0257156_10027475F036797GGAGMSNVDWQNGATDRGRMALPDSYKPKALRLAPTDDTASAEIDPPIVDLLKLEEELGRRRLDEIADVVRALTYGEMMELAASMWNVRPDGGNLTEHNLPAVLYRWSTSRQS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.