Scaffold Ga0257160_1011262

Overview

Basic Information

• Taxon OID: 3300026489
• Scaffold ID: Ga0257160_1011262
• Source Dataset Name: Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1291
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 44.23
  • Long. (^o): -122.22

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064902	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257160_10112622	F064902	GGAG	MNGFSRLTLVEGKLFLREKAALIGVFGLPVALVIGFGLIP