Scaffold Ga0257177_1002989

Overview

Basic Information

• Taxon OID: 3300026480
• Scaffold ID: Ga0257177_1002989
• Source Dataset Name: Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1883
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 44.23
  • Long. (^o): -122.22

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027592	Metagenome / Metatranscriptome	194	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257177_10029891	F027592	N/A	MRTLLLAALWVHLASCVLLTGAFFMLLLAGPPRASAARRWDGMVVTWSRLLVLVALGSGIVWLLVRTAVFENRPHAALEARAVWRAVLDTWPGLVWLARAS