NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228622_1116043

Scaffold Ga0228622_1116043


Overview

Basic Information
Taxon OID3300026479 Open in IMG/M
Scaffold IDGa0228622_1116043 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 26D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)521
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001728Metagenome / Metatranscriptome645Y
F018086Metagenome / Metatranscriptome237Y

Sequences

Protein IDFamilyRBSSequence
Ga0228622_11160431F018086N/AMSANKSYLLGDVELRLDEIKKLSQYFEDILTYNSQRELVPKKDENGKALKKLKLNFSIFQEGNYGQNVSFTIPQSKEQRENNEKKKYVANGKIYYASDDLQSFVQRQESKVENTESVTAD
Ga0228622_11160432F001728N/ANFELRPTDKKDHYRFFINGVDVTGEQERSVFRHIIGVIDNGITTGL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.