NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256326_1027298

Scaffold Ga0256326_1027298


Overview

Basic Information
Taxon OID3300026412 Open in IMG/M
Scaffold IDGa0256326_1027298 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)883
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020197Metagenome / Metatranscriptome225Y
F054064Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0256326_10272981F054064GAGGMTSNLNIPKISKANNMSEKGIKSLVGRKMTKPVKFMGEEVKISKLSVSEVLEIQEKAKNGDVDESAGFDLLKRVIKMSVEGASDLADSDFDSFPMDELSKLSNEIMKFSGIGGTEAS
Ga0256326_10272982F020197N/AMSEDTLKPFSMGYVLRTTAKHMRKSIDISIRKTFERVPEFAGDQQKSQEVFKTLAFLHTMRKQLDDFQSQHSENFKGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.