NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247507_122263

Scaffold Ga0247507_122263


Overview

Basic Information
Taxon OID3300026389 Open in IMG/M
Scaffold IDGa0247507_122263 Open in IMG/M
Source Dataset NameMetatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.12 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)594
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.4447Long. (o)-76.485Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022683Metagenome / Metatranscriptome213N

Sequences

Protein IDFamilyRBSSequence
Ga0247507_1222631F022683N/APLTDFYAKWSKDSLDMMSKGMAMYNRMSRAWTEVGEGSAAEKPEDMLKKWTEAFSGSYNELFEMYAQPFKMFGMGGQTPGKEAWEEAFAKWQKMFTAMPSGPAPAAGDEFMNFSKNWFEGYSKIWQTWMESMQRMGEACKSAVSEGEKPDAAMGAFTEISDRFMQQWSAFVTEQAQAFFTLWRSRLPSEKKEPAKKAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.