Scaffold Ga0256818_1024750

Overview

Basic Information

• Taxon OID: 3300026353
• Scaffold ID: Ga0256818_1024750
• Source Dataset Name: Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PR4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 578
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 31.3377
  • Long. (^o): -81.4644
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010258	Metagenome / Metatranscriptome	306	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256818_10247502	F010258	N/A	MQHKTEGRLVRLLSKHIAAEDQSLEQWFLVAIGDDDKAKDAVAKIATGTDKVIEIVGHIPATSLASWGLTDGDVRLVLPGGPIS