NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208277_1091466

Scaffold Ga0208277_1091466


Overview

Basic Information
Taxon OID3300026292 Open in IMG/M
Scaffold IDGa0208277_1091466 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1125
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008190Metagenome / Metatranscriptome337Y
F018962Metagenome / Metatranscriptome232Y
F046982Metagenome / Metatranscriptome150N

Sequences

Protein IDFamilyRBSSequence
Ga0208277_10914661F046982N/AMKTHRIFNKGQNVYCLLASHTNPNILLPVKGKILDSKWDPVNPLYQIRIVKFYDNMRFLKQHFFDMNFRHMFENRARKMILKAEDFKTANALEK
Ga0208277_10914662F008190AGGAMEDHIEFNFIYSNDALRVKTFLGNVPRSIECINYMDIFNKLTKNDFYQYEPSDAVVSSYLMRQLQNAIGRNISTTIFYVLGSLNKETVGGIQSYVESLSDKPITYKIYHSPDITVNGTAELFDDIIEFE
Ga0208277_10914663F018962N/AMIKIVLEPARNGVIKKVIDDNHGGGREHFTSTDVYEVNENDKNQYSYIKRFFFDLCDDLGLEVGSKFDKTVLDIDTKWGTHFEPTAKDIEFKIKKLKSELKELEEWKTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.