Scaffold Ga0209750_1052976

Overview

Basic Information

• Taxon OID: 3300026237
• Scaffold ID: Ga0209750_1052976
• Source Dataset Name: Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 742
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.534
  • Long. (^o): -110.7978

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026171	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209750_10529762	F026171	GGAG	MSRELKTLRAAVKSARLADLPIAQALKALADMPEARAFQLTPDVLRCMLLESLPEQYAIVLFERAGYRVKIPLADLAYLARHDETLAEIVVSVILYLDKD