Scaffold Ga0209849_1008895

Overview

Basic Information

• Taxon OID: 3300026215
• Scaffold ID: Ga0209849_1008895
• Source Dataset Name: Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1626
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 68.6137
  • Long. (^o): -149.3144
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008136	Metagenome	338	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209849_10088951	F008136	N/A	MARRRNTNEIEQVLEQYRTSGLTQIEYCRQAGMALSTLSRYLRRRGVDQQHLLRVNVESDAESGVGFTLVLGNGRRIESGWRFGEAELARLIRVVEGA