Scaffold Ga0265583_12479

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265583_12479

Scaffold Ga0265583_12479

Overview

Basic Information
Taxon OID	3300026148 Open in IMG/M
Scaffold ID	Ga0265583_12479 Open in IMG/M
Source Dataset Name	Rock biofilm microbial communities from Utah desert near Hanksville, Utah, USA - GBS
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2352
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Rock Biofilm → Utah Desert Microbiome From Environmental Samples Near Hanksville, Utah, Usa

Source Dataset Sampling Location
Location Name	Hanksville, UT, USA
Coordinates	Lat. (^o)	38.41627709	Long. (^o)	-110.78444637	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093266	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265583_124792	F093266	GGA	MEARVEALMENLAMAVMQADHLAADAPEYEVLAETLAYALDLADLGLSAESGAFG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.