Scaffold Ga0209955_1012083

Overview

Basic Information

• Taxon OID: 3300026123
• Scaffold ID: Ga0209955_1012083
• Source Dataset Name: Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2099
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4962
  • Long. (^o): -122.1329
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001488	Metagenome / Metatranscriptome	686	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209955_10120835	F001488	N/A	MARLELTLNFPKSFRIKTFNVKSDKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMDRNSQNLEPGEYI