Scaffold Ga0209920_1016237

Overview

Basic Information

• Taxon OID: 3300026099
• Scaffold ID: Ga0209920_1016237
• Source Dataset Name: Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 972
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4973
  • Long. (^o): -122.1295
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026012	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209920_10162371	F026012	N/A	SVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK