Scaffold Ga0208749_1004792

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208749_1004792

Scaffold Ga0208749_1004792

Overview

Basic Information
Taxon OID	3300026077 Open in IMG/M
Scaffold ID	Ga0208749_1004792 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2880
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location Name	Southern Atlantic ocean
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055735	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208749_10047925	F055735	GAG	MEQINKDLIKNYYQQLAALQKKFWFERLDLKEYCVRYDAINKRIAELENERL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.