NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207700_10588624

Scaffold Ga0207700_10588624


Overview

Basic Information
Taxon OID3300025928 Open in IMG/M
Scaffold IDGa0207700_10588624 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)990
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001142Metagenome / Metatranscriptome766Y
F001173Metagenome / Metatranscriptome757Y
F027951Metagenome / Metatranscriptome193Y

Sequences

Protein IDFamilyRBSSequence
Ga0207700_105886241F001142AGGAMIMGRPATASAQPTDPFAVDEDQALAELDLAWSEGGYHGFTVEGGTWGAISSAGEVLTGGTPDALNLAISTHWQAMRG
Ga0207700_105886242F027951AGGMSQGRDRPDLRVVDGRADPVLGRQRFEQAHPEAVILPPSAGRWRAIVPPGLIPGDGTRTTLGAWNLGDLMDQLDAIYTDSGRDTTG
Ga0207700_105886243F001173N/AAEPGPATGAQRTELTMTAGEETPEIGQWIRDLAAGRRTFADRLADRQSVKIPSEDPDYGDLGQAFPAWSGSPREAILQPPRPEMTPSPRILQRAMDRDAGWEAAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.