NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207646_10000835

Scaffold Ga0207646_10000835


Overview

Basic Information
Taxon OID3300025922 Open in IMG/M
Scaffold IDGa0207646_10000835 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)40092
Total Scaffold Genes52 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)32 (61.54%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005548Metagenome / Metatranscriptome397Y
F012379Metagenome / Metatranscriptome281Y
F015802Metagenome / Metatranscriptome252Y
F020333Metagenome / Metatranscriptome224Y
F021819Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
Ga0207646_1000083519F021819N/AVLANFSTGVSILLLVAAIGPVIALIWFSWRFLRAGKRYDERERAAGRRPPGY
Ga0207646_1000083532F020333GGAVIGVGIALIVIGIIFLFVIPSVGIAAGIVGLALAMIWIAGFGRRAIDRDPYSDRHRV
Ga0207646_100008356F015802GAGVEQGTNAELEAARRELQERYRRFAATRPFSWNRMGDQMQIARLKRRIAQLERQAAGQ
Ga0207646_100008357F012379N/AMVTAAARPHIFWVGNDQERVRGWPIGPALLAMLGDSNGDVHDALADERARLTRQGYASDLPLPALWWNPERGA
Ga0207646_100008359F005548N/AVFRWFFSLFGRGRKAEADPIRESEAYARSYGERSGEIVSVVRQEPKPIPRRTGDMTGELLRRAFEVKLDSRGRAKT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.