NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207662_10003607

Scaffold Ga0207662_10003607


Overview

Basic Information
Taxon OID3300025918 Open in IMG/M
Scaffold IDGa0207662_10003607 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7998
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012128Metagenome / Metatranscriptome283Y
F020185Metagenome / Metatranscriptome225Y
F070168Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0207662_1000360710F070168N/AYWTGLDWNLLHFTTVRGFAGTLFADAAAIGTCESHGLSRDRVFFDAGYSFRVLHDAFGIHQQLLSIDFAVPLNRHDPYAQCLGVPRAPVSRPPFVVLVSFFPAF
Ga0207662_100036077F020185GGAMSRARPVGLLLVGALIASAACGIAIRRDLSTVRPGQVGYDDMCGLQDYFDALEIKTSPPPRLVSGMDVEGTHGGRKVQGGTERFAFENDFLLRHLRRVLEENWRRLPDAVATAPKIEVEVKWSERAGAKRVVTEEDAELIIGDRTFSLPYHPCLSELLYGEPLYRQRRTMWQLPLPGVPAARRPVTDVGAGAPDAAPDGGRADAVSRSAP
Ga0207662_100036078F012128GAGMKTLRHPPSKELWKFCMERLRELRGPDTRERDLANILGFEHSRAVRWKEGQMYVDRAEYLVRLADALDVEPMLLVAMASGTLTVEQAHRQISGVAKNDGEKRRRGNRAEPLELASDASLFALDPSKFDGGRGVVLLIAANGEGRAELGEALGRHVDVGGMVAGSLSMGLCLAERYRPELVFVDLGVANVQAFDACHVLASLSTRAQRRCRVIAGTATVTDAVEKPALMAGAANVTLFPFTLGLFESELGRLEERLGPRKTLRRA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.