NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207695_10024709

Scaffold Ga0207695_10024709


Overview

Basic Information
Taxon OID3300025913 Open in IMG/M
Scaffold IDGa0207695_10024709 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6747
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003703Metagenome / Metatranscriptome473Y
F015512Metagenome / Metatranscriptome254Y

Sequences

Protein IDFamilyRBSSequence
Ga0207695_100247092F003703AGGAGMFLHRVKMNWKKHQTLTLTILLVALARIVLENVFGDGLFSDYATLKFGVVVVIATVAWAFLKTGWELGTFHYKRLCTFVGALRKFCRDYWSKTAAV
Ga0207695_100247093F015512AGGAGMGATVATPEAAADRREPEPRPAVESRPSRERTISTGKPAEETGSRRGGKRRRASKDNEITGTIRYFLTKPTSNGTPELGEEMADEHQALLAAHKADRSFVTIEEWTAKADRRKGVTVLGKDPVVRH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.