NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207647_10301341

Scaffold Ga0207647_10301341


Overview

Basic Information
Taxon OID3300025904 Open in IMG/M
Scaffold IDGa0207647_10301341 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)913
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055995Metagenome / Metatranscriptome138Y
F087786Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0207647_103013411F055995GGAMRRMAGLLFAGGLTAGLGAGMTAIAHASDPVRPAQAWHEIFLPFDHGQGNTMCVDVADGGGTAAGARLWLSRCHGYARNGESQRWQFSGGRFSEVSNTNSGLCIGFPDGGPPVTGARLVQERCDQVPPWQQVRQSRDGTDPYFRLETSGPGGPALCMAAGNLGDNDQTPLVAASCQGFGNAAEILELG
Ga0207647_103013412F087786N/ADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.