NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207680_10136346

Scaffold Ga0207680_10136346


Overview

Basic Information
Taxon OID3300025903 Open in IMG/M
Scaffold IDGa0207680_10136346 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1623
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020185Metagenome / Metatranscriptome225Y
F042391Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0207680_101363461F020185GGAMSRARPVGLLLVGALIASAACGIAIRRDLSTVRPGQVGYDDMCGLQDYFDALEIKTSPPPRLVSGMDVEGTHGGRKVQGGTERFAFENDFLLRHLRRVLEENWRRLPDAVATAPKIEVEVKWSERAGAKRVVTEEDAELIVGDRTFSLPYHPCLSELLYGEPLYRQRRTMWQLPLPGVPAARRPVTDGGAGAPDAAPDGGRADAVSSR
Ga0207680_101363462F042391GGAMERLRELRGPDTRERDLANILGFEHSRAVRWKEGQMYVDRAEYLVRLADALDVEPMLLVAMASGTLTVEQAHRQISGVAKNDGEKRRRGNRAEPLELASDASLFALDPSKFDGGRGVVLLIAANGEGRAELGEALGRHVDVGGMVAGSLSMGLCLAERYRPELVFVDLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.