NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209223_10188739

Scaffold Ga0209223_10188739


Overview

Basic Information
Taxon OID3300025876 Open in IMG/M
Scaffold IDGa0209223_10188739 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1018
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006347Metagenome / Metatranscriptome375Y
F026288Metagenome / Metatranscriptome198Y

Sequences

Protein IDFamilyRBSSequence
Ga0209223_101887391F006347N/ARRNIRRNDIMIDRIEQLITTLEQEINDGYNTLPDYQANNEGKTYVNSAQCTLNELQNQVTELKQGLEQGKNFSLLGENV
Ga0209223_101887394F026288AGGAGMPTAKQSWLNKYETYYAQTEYNKKHYGKRIKQLQAMLEDEEFLEFLTHKEHKEDVLTYLAKSNEFDMYIVFNEQGEPYIADKDFGLINFMKKMSGL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.