NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209533_1126696

Scaffold Ga0209533_1126696


Overview

Basic Information
Taxon OID3300025874 Open in IMG/M
Scaffold IDGa0209533_1126696 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1194
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009561Metagenome / Metatranscriptome316N
F023860Metagenome / Metatranscriptome208N
F087245Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0209533_11266961F023860N/AMFELRNAIRNFLENDLEADVQGAGMSITEPSTADISFKMNNINYLITIDEV
Ga0209533_11266963F087245AGGAGGMTKESLNDSLFELNRIILDLRTKLSKSLQEVLQLRKDLDLEKEEHQLTQLKYESMKNNLDSLISDKLNTAKDAIEEMQKXQNLKMNI
Ga0209533_11266964F009561AGGAGMTELKDEHLEVISKNKSKKYEIDNLVNQLSDAKESVAVLSNAIECGFLHDKHSLILQEWIVEYEELSQQLDTHLTEVRDHGXKST

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.