Basic Information | |
---|---|
Taxon OID | 3300025871 Open in IMG/M |
Scaffold ID | Ga0209311_1079871 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1493 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium ADurb.Bin088 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | 40.12 | Long. (o) | -87.63 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024777 | Metagenome / Metatranscriptome | 204 | Y |
F025938 | Metagenome / Metatranscriptome | 199 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209311_10798711 | F024777 | AGGAG | MDAELIFAEDVEVCPKCGSSEFWENRIIWTGDDPTDEELASIECKGCGAVFYARDYYRRRFGKLEDDDEEIPF |
Ga0209311_10798713 | F025938 | AGGAG | MVVIPDKIVDWFASVFEDVRDKQFLIGDQLIEIIKVTGDKGGTIAYIAGRLGVSASTLYDYYRIAKLWTPEYRAMYQALDWTIYRNADPNDPEDRALLDRCVDEQWSSATFKENKYPALKDPNTIIGKMIALGKRIYEQDTLDIEQREAIHKAIGLLEEVMRELEVVEFADVKF |
⦗Top⦘ |