NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209311_1020656

Scaffold Ga0209311_1020656


Overview

Basic Information
Taxon OID3300025871 Open in IMG/M
Scaffold IDGa0209311_1020656 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3585
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)40.12Long. (o)-87.63Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055749Metagenome / Metatranscriptome138N
F103315Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0209311_10206561F055749GAGGVPENNNPMNLIIAIAIGILTLIAVFSVIPVVGGSIDNAMPPLDEGSDWNTTTNPDLPSGASMWSQLGPLLVLAVLAMVIGLVIMYFRNAAG
Ga0209311_10206563F103315GGAGGMITVEIYIFLAAVVAAAFVYIFLDLDNRLYGNLFAASFAGIMAGLLALWTFNENTVYITTVPETAITVDHYLNDTLANVTTTYAYQTHIVPIVDPALGYFWMLVMIFMWFLVGYFVLEIMHESRMPDDEEAYE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.