NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209717_1044924

Scaffold Ga0209717_1044924


Overview

Basic Information
Taxon OID3300025855 Open in IMG/M
Scaffold IDGa0209717_1044924 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2189
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.12Long. (o)-87.64Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012026Metagenome / Metatranscriptome284Y
F074914Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0209717_10449242F012026AGGAGGMNLKEVQAQTAALIGKRAEAINILHRLEKVEDRFNPKIIAEINGYKQAIEELSKELNRLEVEKGALLEAEEAARKEYITALAAYDELYGRFPNAEKEAGELLKRYAKHVEAAQRAREILMTKMTALAAVSGAYLPIPPQIGHAWREYAREYAFEIEHKGGV
Ga0209717_10449245F074914AGGGGGMKISTLLRKANAALCKIESLNPEEIDREVFKMEIEKARAIAYLVRTVSEIIAKNEMEDRIAALENA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.