Scaffold Ga0209176_10167467

Overview

Basic Information

• Taxon OID: 3300025854
• Scaffold ID: Ga0209176_10167467
• Source Dataset Name: Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 552
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: USA: Barrow Environmental Observatory site, Alaska
• Coordinates
  • Lat. (^o): 71.299
  • Long. (^o): -156.61

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007107	Metagenome / Metatranscriptome	357	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209176_101674672	F007107	N/A	AAPPQSQAQQNVILQMAEKASNGKELLLVMRAAVGAFPAGTASREHPAESRVVSIVTAKMIELGTLDQLIECATQYSVNPESARPFVQRMFQLAGQNSDARVWYGIRVAAFHLKVGDLQRQAQARGDQLAGR