NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209182_10065395

Scaffold Ga0209182_10065395


Overview

Basic Information
Taxon OID3300025843 Open in IMG/M
Scaffold IDGa0209182_10065395 Open in IMG/M
Source Dataset NameLake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1040
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameRussia: Lake Baikal
CoordinatesLat. (o)53.7598Long. (o)107.9791Alt. (m)Depth (m)0 to .05
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051790Metagenome / Metatranscriptome143Y
F061810Metagenome / Metatranscriptome131N

Sequences

Protein IDFamilyRBSSequence
Ga0209182_100653954F061810GGALTSTGGGSVIPVDPPILRRDLLQEDEFFVLQEDGTGKIVLSFGTYDRMATEQGTDLILTEASDKFILTVY
Ga0209182_100653955F051790N/AMADTKITALTALTAADPANDVIPIVDVSDPTMAASG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.