Scaffold Ga0209600_1028133

Overview

Basic Information

• Taxon OID: 3300025821
• Scaffold ID: Ga0209600_1028133
• Source Dataset Name: Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2127
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Germany:Helgoland, sampling site Kabeltonne, North Sea
• Coordinates
  • Lat. (^o): 54.1883
  • Long. (^o): 7.9
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078157	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209600_10281331	F078157	N/A	MLYISCLQPTGVSPALNNRRRASSSSYVSQQKTLMKKKKKEEESAACQFTFLLDKPGCMDARMDEDEPCDVNLECPLEPFDISKCLKRHKGVLKMGVNHAVRFTLNAENLFVSPLPGSTIFLDDEVVTDKMTKMLEDGSRLR