NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209199_1029290

Scaffold Ga0209199_1029290


Overview

Basic Information
Taxon OID3300025809 Open in IMG/M
Scaffold IDGa0209199_1029290 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3150
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005012Metagenome / Metatranscriptome415Y
F007392Metagenome / Metatranscriptome352Y
F012576Metagenome / Metatranscriptome279Y

Sequences

Protein IDFamilyRBSSequence
Ga0209199_10292902F012576N/AMNLLLAYIQFIFIGLVIYGSVLTFDNISINTSVSGIIAPILAWFAGTGLRASFNSENNIQKKGSIFMAVIVLAISYLWINSTGYWYVAHAIEISGKNLLIISFFIGFLGTTKSISDLNTK
Ga0209199_10292903F005012GGAMKSILILLLLFPSIGFADDFELLCKGEETKYLDGDLSSKEVTTKVIGIQLYEEGMRLDGEWFDNKSDLTEDYLLERSYVKSKDNILAARNFSTNALIEGQEIQTIKIDNVEINLLANDIFWTHEFNRVVKTNNEAKTIYAFRKSFKGACK
Ga0209199_10292904F007392GAGLKILLLLSMFFCSLAFSQDFNLICEGERKVRYLSGKEFNVTNFESVLLKINNNAMEYIGVNSGRTYFFSNREYTAPKWPPHEDIKITEQYQFTPKTIKASQMIADTGDSEESSINLFSLDVNLLTGELNETEIIRNKKTNVKSMSNKFQALCKREDRSY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.