Scaffold Ga0209137_1202484

Overview

Basic Information

• Taxon OID: 3300025767
• Scaffold ID: Ga0209137_1202484
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 668
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet, British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037207	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209137_12024842	F037207	GGAG	VGVDAGALKSQEERLLGFTKETSDFIKKIQTALLNPTVLFVMITFIFILAIETLWGSYFKTQDSKDFAKGSPKFIRAMTYFSWISGTILAFGVCMYLAGPFLFGDVFGPKDQEIIGIVTGSLIFVYFINALVTGFGGAPTY