Scaffold Ga0208899_1111490

Overview

Basic Information

• Taxon OID: 3300025759
• Scaffold ID: Ga0208899_1111490
• Source Dataset Name: Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1000
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Delaware Bay
• Coordinates
  • Lat. (^o): 39.12
  • Long. (^o): -75.25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077332	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208899_11114902	F077332	AGG	MRYTLRVNCGNGQIENIWSGNEMSEAIHFEAIAIKHWGKDNVWIADVVTEISVG