NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207713_1105105

Scaffold Ga0207713_1105105


Overview

Basic Information
Taxon OID3300025735 Open in IMG/M
Scaffold IDGa0207713_1105105 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)968
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000466Metagenome / Metatranscriptome1105Y
F009553Metagenome / Metatranscriptome316Y

Sequences

Protein IDFamilyRBSSequence
Ga0207713_11051051F000466N/ARKWKDEKQVAYQSVVKRDWVPTGRIDFATRLNGNSPDADQPSEFKLLIEERRIVESIAGSENLEIQWRPATLKEAKAVVAQYHKYLSEHSLIKTVFEDTLSLPPPRRA
Ga0207713_11051052F009553AGGMTDTRETKKNYAYVMVRMNKSDVREFFDGFLVHVPWVRAVSIEGQEGVKLQLATPWNQLPTGSKVTVKMPRKKFGMFLADVLRLRAPRGKDGDAVTLVTPRDKLEEFLSLLPESVKLISCPEDSARSDSRKPI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.