Scaffold Ga0209606_1037514

Overview

Basic Information

• Taxon OID: 3300025730
• Scaffold ID: Ga0209606_1037514
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2326
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.53
  • Long. (^o): -90.43

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029768	Metagenome / Metatranscriptome	187	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209606_10375142	F029768	AGGAGG	MTETAVAVNAVYSEQELKKDSQVSVRLESGLFEALETQTKVWGFKSISQTVRAILTFYFLPVVYELELKNRSISEHKEFLKEKQEEGFSLEQAKANYFTFQVVEYLEFLEQAMVMARHSLKFMESTSDKMNGILRETVNKIEQAMKELEQGAE