Scaffold Ga0208196_1072146

Overview

Basic Information

• Taxon OID: 3300025724
• Scaffold ID: Ga0208196_1072146
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1289
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 37.43
  • Long. (^o): 138.83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080092	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208196_10721461	F080092	N/A	GSIVVNTDESWETSNNLMRFGTVNDSYLYNGKSQTIISLGRTGIMKQDSTKVETLGMLNAFDSAGMFATQTNIPESICDQSNFIAGYGNQSSSRYPETQTVEGLWGLMGSGPGTTYESQIEVVGTVVGVSVQGTSPQGYLYEDVKGSLKAGLDKNSSALQYSYSRHDHGLLTSDENKSLDGGFDWLWDTNADEIVSANESVTNETEEGE