Scaffold Ga0208197_1042319

Overview

Basic Information

• Taxon OID: 3300025720
• Scaffold ID: Ga0208197_1042319
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1924
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 37.43
  • Long. (^o): 138.83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067651	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208197_10423193	F067651	GGAG	MEKNEINQTTLHPKKTDLSGYEGLVVAMLEIMMRDLTIPDREIEISLHDSKEVIEQKKKKKGYKRSAYCFVRSEWFEDLCWFIGVNPDPIR