NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208195_1004628

Scaffold Ga0208195_1004628


Overview

Basic Information
Taxon OID3300025713 Open in IMG/M
Scaffold IDGa0208195_1004628 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10713
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium ADurb.Bin003(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA, Massachusetts, Boston
CoordinatesLat. (o)42.35Long. (o)-70.96Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047076Metagenome / Metatranscriptome150N
F070167Metagenome / Metatranscriptome123N
F077342Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0208195_10046283F070167AGGAMSWLGNALFGQSRLKGYDMTPQQLTQAYTPKTYSVDTSRYTALGEEFLDPYSSRNRGMYNDLKKVGVDAAAQQYLNSMRMQAAGQNPFATGQLQSSLASNLEGTRQAYNSYLNNAYQTGTGLLGYSLQGNLANAAAQNTAAMQGSQSALNYQLQKMQADAAMQMQRSQNQSGFFGGLFGNLVGASPALLFGTQSPTGLLNLLGL
Ga0208195_10046286F077342AGGAGMARTLNEFVSSTGNYVYEITDAEMAGVDLTDFNVAVLLHCVLANELERDFIVFSKGNIDQVFDINMQYFLLYSPTYCRNIGNGIFIVSLPFWRMQHIAESENSDIVSAEFEVVIYGFNTLEYPNGEDKGAASFQCIVIDTGTINFTKNRFPLPLTSVVDEPAKEQRREIPKRIF
Ga0208195_10046289F047076AGGAGGMKNGELLALAQLIVPELTAKAFVQFYNIAFEKISREVRLQTQILKPKIVNQYEDLNNFMKLDIVKIDSVKDASGDDIFWEVRHRKLLIYDSNKELITDATIGNHKLEIEYWVRISKAIKLSFPTDDDIESNPNIIEEWNEMIPGVEDTEVQLCALYLMITELAGIFPMEPGTVELYANKFSGAFQAVKTKYNSGNSPATITQVYF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.