NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209201_1020476

Scaffold Ga0209201_1020476


Overview

Basic Information
Taxon OID3300025708 Open in IMG/M
Scaffold IDGa0209201_1020476 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3422
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.53Long. (o)-90.43Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014002Metagenome / Metatranscriptome266Y
F027161Metagenome / Metatranscriptome195Y
F030054Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0209201_10204762F030054GGAMSNREKWFLLIICLLLLVIMFSGESFRKKNKLIKENKTLISDYKHRINSNKLMIDSLNFELKSAKKTDTVIKIRYKQKIDSVYVYNYYDYVVFYDTLLNTNIAAADTFLCFDSISVQKITIKLVNCSLDSELLANCLIQNNLYANIINIQDSVISLKDSVNASLEDMYKQKVKKVKRQRNVATGVAFTELLLILGILVK
Ga0209201_10204764F027161AGAAGGMAMNEYIKLILDNLDITYVCSVMLIGYIFTKSSLITKIKIKKRWLIAIIGVLVAIFYYFVLKVRLDVLFFSFITAQFLNLYVTEYLIDYMIKKYLQKK
Ga0209201_10204765F014002N/AMEFNFNISELISIIALLIAIIGGYVNTKIQITKLVEENKNLSEKITNLDKKLSEICKKVDRIKIILAKEGLNGNE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.