NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209667_1007190

Scaffold Ga0209667_1007190


Overview

Basic Information
Taxon OID3300025707 Open in IMG/M
Scaffold IDGa0209667_1007190 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6062
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)125
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005749Metagenome391Y
F101492Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0209667_10071902F005749GAGMKKSWLLTMSFDEHDGSPNNIKTLYHGRAKRDMVKDMNLFQDMNEHLVLALVEIDEKSTYDKIIDKEDTEEMFFMDSKKNWNDGKTYEDLKDEVLEEILTGSLINGDMGYA
Ga0209667_10071906F101492AGGAGMFKTAAELGREFRSEIIPMLKSKGFDLKIASSRKSYYHDGKLGVKITKVPTNFPVWVSKYSRWDRTKNADRLLATIEDRINILISNNNVKLETKGDGGLDIRVGVEFGQSVKYIPYEKDESNESD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.