Scaffold Ga0208769_1068244

Overview

Basic Information

• Taxon OID: 3300025697
• Scaffold ID: Ga0208769_1068244
• Source Dataset Name: Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1088
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Salicibibacter → Salicibibacter cibarius (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Ace Lake, Antarctica
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088315	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208769_10682441	F088315	GGTGG	MARGKLYMPSDTDRIFVERAVMAGTPIEKIAGCLNLHDDTLRKHFRYEIMTGRERLKGDAIRVLVDSLTDNSLDAAKFVLGRVAGWTEKSVVDNTSSDKSMTP