Scaffold Ga0209532_1141380

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209532_1141380

Scaffold Ga0209532_1141380

Overview

Basic Information
Taxon OID	3300025696 Open in IMG/M
Scaffold ID	Ga0209532_1141380 Open in IMG/M
Source Dataset Name	Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	758
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location Name	Helgoland, sampling site Kabeltonne
Coordinates	Lat. (^o)	54.184167	Long. (^o)	7.9	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091881	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209532_11413802	F091881	GGAGG	MRIGDLVRIKKAWKDLYEGYEDIVGLVVYADCGYGGERPVGFRRIRIMHGDIRGQVYSVFVEDVLEVVKN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.