Scaffold Ga0208019_1010583

Overview

Basic Information

• Taxon OID: 3300025687
• Scaffold ID: Ga0208019_1010583
• Source Dataset Name: Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3948
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Chesapeake Bay
• Coordinates
  • Lat. (^o): 38.9819
  • Long. (^o): -76.3716

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008550	Metagenome / Metatranscriptome	331	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208019_10105833	F008550	AGG	MLTKQILDHTGNIMSEFIVDEVDSRSLQIRHKVTQDIEPTLKLAKVLRDNQHLDNFANKDSGWKRVAEIPRVLYDELHRQGITRDKKKFKQWLNDYHNKPFRVWEGHL