NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208162_1006964

Scaffold Ga0208162_1006964


Overview

Basic Information
Taxon OID3300025674 Open in IMG/M
Scaffold IDGa0208162_1006964 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5057
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (65.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)38.9819Long. (o)-76.3716Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003331Metagenome / Metatranscriptome493Y
F038154Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0208162_100696413F038154GGAMTYDEFVSKSPEYYMDMVRLIDIKLKHRMELTEEEKEINGYIVEVQERNKINELRNKFQKCWEIDD
Ga0208162_10069647F003331GGAGMTLTEKDKIFRNVWSCAYRRRYNAKIKGDWELYDREHQTILMCLKIAKWTKFDTEKSKH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.