NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208428_1002481

Scaffold Ga0208428_1002481


Overview

Basic Information
Taxon OID3300025653 Open in IMG/M
Scaffold IDGa0208428_1002481 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7450
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (20.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008190Metagenome / Metatranscriptome337Y
F029447Metagenome / Metatranscriptome188Y
F042621Metagenome / Metatranscriptome158Y
F059985Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0208428_10024812F042621AGGAMDNLEKEQLQWIKGDKIGTVEVISGNDGEWTTFESGSRIATSLISEFLMPIDGEPLDFSPPNPALTKAAETYKEKVTTQPKVASPIRTLFDKQKKNDSVKLNLTFPIDVPKKAIYEIISTSFDLDEVNEELESYIKDQISEDLVKDSLFESIKQLIKSRYQAN
Ga0208428_10024814F059985AGGAGGMVKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYEESDSDSNRYEYIMKFFFELCEDLGLECGNKFDKNVLQFDTVWGTHYEPNKKEVESKIRELQAEIDLLKEWKQA
Ga0208428_10024815F008190N/AMETSIEFNFIYSKDAVRVKSFLGTVPRNIECINYMDIFNKLTKNDFYQFEPSDAVVSSYLMKQLQTILDRSTTTSIFYVLGNLNERTVIGVKNYVETLTDRDIEYNIYHSPDINVNGTAELFKNVVEFE
Ga0208428_10024818F029447N/AMNIKSLALKNKLIEERTGEFYYDLTAPSFTYDADLGVKALHYVQIDQVGRIDKISELYFGSGEFIDAICVVNNIFNPFTIAEGDILVIPNLSRQDLVYSRPNPASRPNSTQEAYIDTGRQSEKDQGRMQRLIEKAKTSKAGVKQPMPPNMLQPGQETKQYEGGKIKLGTNLNSRNTKAN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.