NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208507_1002586

Scaffold Ga0208507_1002586


Overview

Basic Information
Taxon OID3300025648 Open in IMG/M
Scaffold IDGa0208507_1002586 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9274
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021463Metagenome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0208507_10025868F021463N/AMSDQLETRVVRLEVTQANHEDDIKELRKSATDLSKAMASIEKNLAQIKYIAIGALAVVLTQSLGLDRAIKLLFGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.