Scaffold Ga0208480_1002264

Overview

Basic Information

• Taxon OID: 3300025633
• Scaffold ID: Ga0208480_1002264
• Source Dataset Name: Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6779
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Barrow Environmental Observatory site, Barrow, Alaska
• Coordinates
  • Lat. (^o): 71.2999
  • Long. (^o): -156.61

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030498	Metagenome / Metatranscriptome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208480_10022647	F030498	AGGAG	MSNTPLTLRQPAGSFWSARREASLNWLALGLLLAAWNATDNDAPENARRRPEALRNYPNVSVRAAHRAATVDP