NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208693_1004948

Scaffold Ga0208693_1004948


Overview

Basic Information
Taxon OID3300025618 Open in IMG/M
Scaffold IDGa0208693_1004948 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7724
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (72.73%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)37.8Long. (o)-122.27Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099240Metagenome / Metatranscriptome103N
F101424Metagenome / Metatranscriptome102Y
F105431Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0208693_10049481F099240AGGMKLLFNYSDFHKFPLNVCFSTLRLLLIDNFDGVYKDTNGKLIAVFDYHETEREQRIIRSASSFLEIYGYDLKRHTEIVDSIEHLKYVTKTCG
Ga0208693_10049483F105431AGGMDNDTIIKLIEKYGMHNRGKSKLISYLKGEHITRKEAIYAYCYDCQGYCEDGKVECDQTQCPLYTYSQFNKYNINKSEKE
Ga0208693_10049487F101424AGGMNYIEGLKIIGWIVLIVVCIALLFIWYAAFCYVAYVLLGMIGITGLWQTICGIVLGLFVASLPMSIGHYNKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.