Scaffold Ga0209608_1006326

Overview

Basic Information

• Taxon OID: 3300025609
• Scaffold ID: Ga0209608_1006326
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC130_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5822
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (90.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Canada
• Coordinates
  • Lat. (^o): 49.25
  • Long. (^o): -123.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067651	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209608_10063264	F067651	GGAGG	MEKNQDKPNGYYLYQDDLLSGYEGIVVAMLKLMMRDLTIPDSEIEVSAHDSGEVMERKKKKKFYKCSAYRFVRSEWFDDLCWGMGVNPHLIRRYAIECYNESKKK